PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1542_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 209aa    MW: 23730.3 Da    PI: 9.6426
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1542_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81.1e-1256100347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT++E+ +++ + + +G+g+W+ I+r +   +t+ q+ s+ qky
  cra_locus_1542_iso_2_len_1406_ver_3  56 PWTEDEHRRFLLGLQAHGKGDWRNISRNFVRSKTPTQVASHAQKY 100
                                          7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-1046105IPR009057Homeodomain-like
PROSITE profilePS5129416.37948105IPR017930Myb domain
SuperFamilySSF466891.79E-1650104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1752104IPR006447Myb domain, plants
SMARTSM007172.9E-953103IPR001005SANT/Myb domain
PfamPF002494.9E-1056100IPR001005SANT/Myb domain
CDDcd001678.87E-956101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MATLYPPSSY MGNSNWILPQ NKSSRWTEEE NKQFESALAL IDERRTCDQE RKKGIPWTED  60
EHRRFLLGLQ AHGKGDWRNI SRNFVRSKTP TQVASHAQKY FLRQLSGGKD KKRPSIHDIT  120
TVHLPNTSPS DDNKSPNSSD KSAPSASSKL LLDWNNSNDG LLMVFDSNHG NESMESLFDI  180
ASRGHRYAAN ICTTANSRFH IQPTKYVHG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275014.13e-66PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H77e-49DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068V2E52e-86A0A068V2E5_COFCA; Uncharacterized protein
STRINGVIT_13s0019g03370.t019e-66(Vitis vinifera)